PDB entry 1hyo

View 1hyo on RCSB PDB site
Description: crystal structure of fumarylacetoacetate hydrolase complexed with 4-(hydroxymethylphosphinoyl)-3-oxo-butanoic acid
Class: hydrolase
Keywords: beta-sandwich roll, HYDROLASE
Deposited on 2001-01-21, released 2001-02-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.181
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fumarylacetoacetate hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hyoa1, d1hyoa2
  • Chain 'B':
    Compound: fumarylacetoacetate hydrolase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35505 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.06: d1hyob1, d1hyob2, d1hyob3
  • Heterogens: MG, CA, NI, ACT, HBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hyoA (A:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyoA (A:)
    msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh
    vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlpat
    igdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmgqm
    rpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsardiq
    qweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdinls
    vslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpesfg
    smlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hyoB (B:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpalsp
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyoB (B:)
    gsmsfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskh
    qhvfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
    atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
    qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
    iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
    lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
    fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpals