PDB entry 1hyg

View 1hyg on RCSB PDB site
Description: Crystal structure of MJ0490 gene product, the family of lactate/malate dehydrogenase
Deposited on 2001-01-19, released 2001-04-25
The last revision prior to the SCOP 1.67 freeze date was dated 2001-04-25, with a file datestamp of 2001-04-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hygA (A:)
    mkvtiigasgrvgsatalllakepfmkdlvligrehsinkleglrediydalagtrsdan
    iyvesdenlriidesdvviitsgvprkegmsrmdlaktnakivgkyakkiaeicdtkifv
    itnpvdvmtykalvdskfernqvfglgthldslrfkvaiakffgvhidevrtriigehgd
    smvpllsatsiggipiqkferfkelpideiiedvktkgeqiirlkggsefgpaaailnvv
    rcivnnekrlltlsayvdgefdgirdvcigvpvkigrdgieevvsieldkdeiiafrksa
    eiikkyceevknl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hygB (B:)
    mkvtiigasgrvgsatalllakepfmkdlvligrehsinkleglrediydalagtrsdan
    iyvesdenlriidesdvviitsgvprkegmsrmdlaktnakivgkyakkiaeicdtkifv
    itnpvdvmtykalvdskfernqvfglgthldslrfkvaiakffgvhidevrtriigehgd
    smvpllsatsiggipiqkferfkelpideiiedvktkgeqiirlkggsefgpaaailnvv
    rcivnnekrlltlsayvdgefdgirdvcigvpvkigrdgieevvsieldkdeiiafrksa
    eiikkyceevknl