PDB entry 1hye

View 1hye on RCSB PDB site
Description: crystal structure of the mj0490 gene product, the family of lactate/malate dehydrogenase, dimeric structure
Deposited on 2001-01-19, released 2001-04-18
The last revision prior to the SCOP 1.67 freeze date was dated 2001-04-18, with a file datestamp of 2001-04-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hyeA (A:)
    mkvtiigasgrvgsatalllakepfmkdlvligrehsinkleglrediydalagtrsdan
    iyvesdenlriidesdvviitsgvprkegmsrmdlaktnakivgkyakkiaeicdtkifv
    itnpvdvmtykalvdskfernqvfglgthldslrfkvaiakffgvhidevrtriigehgd
    smvpllsatsiggipiqkferfkelpideiiedvktkgeqiirlkggsefgpaaailnvv
    rcivnnekrlltlsayvdgefdgirdvcigvpvkigrdgieevvsieldkdeiiafrksa
    eiikkyceevknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hyeA (A:)
    mkvtiigasgrvgsatalllakepfmkdlvligrehsinkleglrediydalagtrsdan
    iyvesdenlriidesdvviitsgvprkegmsrmdlaktnakivgkyakkiaeicdtkifv
    itnpvdvmtykalvdskfernqvfglgthldslrfkvaiakffgvhidevrtriigehgd
    smvpllsatsiggipiqkferfkelpideiiedvktkgeqiirfgpaaailnvvrcivnn
    ekrlltlsayvdgefdgirdvcigvpvkigrdgieevvsieldkdeiiafrksaeiikky
    ceevknl