PDB entry 1hy2

View 1hy2 on RCSB PDB site
Description: miniprotein mp-1 complex with streptavidin
Class: unknown function
Keywords: conformational ensemble, mini-proteins, disulphide constrained loops, entropically restrained proteins, peptides
Deposited on 2001-01-17, released 2003-06-17
The last revision prior to the SCOP 1.75 freeze date was dated 2003-06-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hy2a_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hy2b_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hy2c_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hy2d_
  • Chain 'E':
    Compound: mp-1
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: mp-1
    Species: synthetic, synthetic
  • Chain 'G':
    Compound: mp-1
    Species: synthetic, synthetic
  • Chain 'H':
    Compound: mp-1
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hy2A (A:)
    gaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy2A (A:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hy2B (B:)
    gaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy2B (B:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hy2C (C:)
    gaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy2C (C:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hy2D (D:)
    gaaeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsg
    talgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtf
    tkvkpsaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hy2D (D:)
    aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
    lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
    vkp
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.