PDB entry 1hxw

View 1hxw on RCSB PDB site
Description: hiv-1 protease dimer complexed with a-84538
Class: aspartyl protease
Keywords: aspartyl protease, hydrolase, aspartic proteinase, hiv
Deposited on 1997-01-24, released 1998-02-04
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12499 (0-98)
  Domains in SCOP 1.73: d1hxwa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12499 (0-98)
  Domains in SCOP 1.73: d1hxwb_
• Heterogens: RIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hxwA (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hxwB (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf