PDB entry 1hxm

View 1hxm on RCSB PDB site
Description: crystal structure of a human vgamma9/vdelta2 t cell receptor
Deposited on 2001-01-16, released 2001-06-20
The last revision prior to the SCOP 1.59 freeze date was dated 2001-07-11, with a file datestamp of 2001-07-11.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: 0.219
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxmA (A:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxmB (B:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxmC (C:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxmD (D:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxmE (E:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxmF (F:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxmG (G:)
    aielvpehqtvpvsigvpatlrcsmkgeaignyyinwyrktqgntmtfiyrekdiygpgf
    kdnfqgdidiaknlavlkilapserdegsyycacdtlgmggeytdklifgkgtrvtvepr
    sqphtkpsvfvmkngtnvaclvkefypkdirinlvsskkitefdpaivispsgkynavkl
    gkyedsnsvtcsvqhdnktvhstdfe
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hxmH (H:)
    aghleqpqisstktlsktarlecvvsgitisatsvywyrerpgeviqflvsisydgtvrk
    esgipsgkfevdripetststltihnvekqdiatyycalweaqqelgkkikvfgpgtkli
    itdkqldadvspkptiflpsiaetklqkagtylcllekffpdvikihweekksntilgsq
    egntmktndtymkfswltvpeksldkehrcivrhennkngvdqeiifppi