PDB entry 1hx8

View 1hx8 on RCSB PDB site
Description: crystal structure of n-terminal domain of drosophila ap180
Deposited on 2001-01-12, released 2001-02-28
The last revision prior to the SCOP 1.67 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hx8A (A:)
    mtmagqtindrllaarhslagqglaksvckatteecigpkkkhldylvhcanepnvsiph
    lanlliersqnanwvvvykslitthhlmaygnerfmqylassnstfnlssfldkgtvqdg
    gmgvpggrmgydmspfirryakylnekslsyramafdfckvkrgkeegslrsmnaekllk
    tlpvlqaqldallefdcqsndlsngvinmsfmllfrdlirlfacyndgiinllekyfdmn
    kkhardaldlykkflvrmdrvgeflkvaenvgidkgdipdltkapsslldaleqhlatl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx8A (A:)
    qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
    itthhlmaygnerfmqylassnstfnlssfldkgtggmgvpggrmgydmspfirryakyl
    nekslsyramafdfckvegslrsmnaekllktlpvlqaqldallefdcqsndlsngvinm
    sfmllfrdlirlfacyndgiinllekyfdmnkkhardaldlykkflvrmdrvgeflkvae
    nvgidkgdipdltkapsslldaleqhlatl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hx8B (B:)
    mtmagqtindrllaarhslagqglaksvckatteecigpkkkhldylvhcanepnvsiph
    lanlliersqnanwvvvykslitthhlmaygnerfmqylassnstfnlssfldkgtvqdg
    gmgvpggrmgydmspfirryakylnekslsyramafdfckvkrgkeegslrsmnaekllk
    tlpvlqaqldallefdcqsndlsngvinmsfmllfrdlirlfacyndgiinllekyfdmn
    kkhardaldlykkflvrmdrvgeflkvaenvgidkgdipdltkapsslldaleqhlatl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hx8B (B:)
    qglaksvckatteecigpkkkhldylvhcanepnvsiphlanlliersqnanwvvvyksl
    itthhlmaygnerfmqylassnstfnlssfldkgtmgvpggrmgydmspfirryakylne
    kslsyramafdfckvkegslrsmnaekllktlpvlqaqldallefdcqsndlsngvinms
    fmllfrdlirlfacyndgiinllekyfdmnkkhardaldlykkflvrmdrvgeflkvaen
    vgidkgdipdltkapsslldaleqhlatl