PDB entry 1hwy

View 1hwy on RCSB PDB site
Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate
Deposited on 2001-01-10, released 2001-01-31
The last revision prior to the SCOP 1.67 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.23
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyA (A:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyB (B:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyC (C:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyD (D:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyE (E:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hwyF (F:)
    adreddpnffkmvegffdrgasivedklvedlktrqtqeqkrnrvrgilriikpcnhvls
    lsfpirrddgsweviegyraqhshqrtpckggirystdvsvdevkalaslmtykcavvdv
    pfggakagvkinpknytdedlekitrrftmelakkgfigpgvdvpapnmstgeremswia
    dtyastighydinahacvtgkpisqggihgrisatgrgvfhgienfienasymsilgmtp
    gfgdktfavqgfgnvglhsmrylhrfgakcvavgesdgsiwnpdgidpkeledfklqhgt
    ilgfpkakiyegsilevdcdilipaasekqltksnaprvkakiiaegangpttpqadkif
    lernimvipdlylnaggvtvsyfqilknlnhvsygrltfkyerdsnyhllmsvqeslerk
    fgkhggtipivptaefqdrisgasekdivhsglaytmersarqimrtamkynlgldlrta
    ayvnaiekvfrvyneagvtft