PDB entry 1hwr
View 1hwr on RCSB PDB site
Description: molecular recognition of cyclic urea hiv protease inhibitors
Class: aspartyl protease
Keywords: aspartyl protease, hydrolase, acid proteinase
Deposited on
1998-03-20, released
1999-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-29, with a file datestamp of
2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1hwra_ - Chain 'B':
Compound: hiv-1 protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1hwrb_ - Heterogens: 216
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1hwrA (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1hwrB (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigatlnf