PDB entry 1hvh

View 1hvh on RCSB PDB site
Description: nonpeptide cyclic cyanoguanidines as hiv protease inhibitors
Deposited on 1997-12-13, released 1998-12-30
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-06, with a file datestamp of 1999-04-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hvha_
  • Chain 'B':
    Domains in SCOP 1.55: d1hvhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvhA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hvhB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigatlnf