PDB entry 1hv8

View 1hv8 on RCSB PDB site
Description: crystal structure of a dead box protein from the hyperthermophile methanococcus jannaschii
Deposited on 2001-01-08, released 2001-02-21
The last revision prior to the SCOP 1.57 freeze date was dated 2001-02-21, with a file datestamp of 2001-02-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.27
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv8A (A:)
    veymnfnelnlsdnilnairnkgfekptdiqmkviplflndeynivaqartgsgktasfa
    iplielvnenngieaiiltptrelaiqvadeieslkgnknlkiakiyggkaiypqikalk
    nanivvgtpgrildhinrgtlnlknvkyfildeademlnmgfikdvekilnacnkdkril
    lfsatmpreilnlakkymgdysfikakinanieqsyvevnenerfealcrllknkefygl
    vfcktkrdtkelasmlrdigfkagaihgdlsqsqrekvirlfkqkkiriliatdvmsrgi
    dvndlncvinyhlpqnpesymhrigrtgragkkgkaisiinrreykklryieramklkik
    klk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv8B (B:)
    veymnfnelnlsdnilnairnkgfekptdiqmkviplflndeynivaqartgsgktasfa
    iplielvnenngieaiiltptrelaiqvadeieslkgnknlkiakiyggkaiypqikalk
    nanivvgtpgrildhinrgtlnlknvkyfildeademlnmgfikdvekilnacnkdkril
    lfsatmpreilnlakkymgdysfikakinanieqsyvevnenerfealcrllknkefygl
    vfcktkrdtkelasmlrdigfkagaihgdlsqsqrekvirlfkqkkiriliatdvmsrgi
    dvndlncvinyhlpqnpesymhrigrtgragkkgkaisiinrreykklryieramklkik
    klk