PDB entry 1hv2

View 1hv2 on RCSB PDB site
Description: solution structure of yeast elongin c in complex with a von hippel-lindau peptide
Class: signaling protein
Keywords: protein-peptide complex, SIGNALING PROTEIN
Deposited on 2001-01-05, released 2001-09-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongin c
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1hv2a_
  • Chain 'B':
    Compound: von hippel-lindau disease tumor suppressor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hv2A (A:)
    msqdfvtlvskddkeyeisrsaamisptlkamiegpfreskgrielkqfdshilekavey
    lnynlkysgvsedddeipefeiptemslelllaadylsi
    

  • Chain 'B':
    No sequence available.