PDB entry 1huz

View 1huz on RCSB PDB site
Description: crystal structure of dna polymerase complexed with dna and cr-pcp
Deposited on 2001-01-04, released 2001-04-23
The last revision prior to the SCOP 1.65 freeze date was dated 2001-05-14, with a file datestamp of 2001-05-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1huzA (A:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1huzA (A:)
    tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkne
    dklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessg
    dmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendene
    yphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvage
    plpvdseqdifdyiqwryrepkdrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1huzB (B:)
    mskrkapqetlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeak
    klpgvgtkiaekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegik
    tledlrknedklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgs
    frrgaessgdmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcq
    lpsendeneyphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirp
    lgvtgvageplpvdseqdifdyiqwryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1huzB (B:)
    tlnggitdmlvelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
    aekideflatgklrklekirqddtsssinfltrvtgigpsaarklvdegiktledlrkne
    dklnhhqriglkyfedfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessg
    dmdvllthpnftsesskqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendene
    yphrridirlipkdqyycgvlyftgsdifnknmrahalekgftineytirplgvtgvage
    plpvdseqdifdyiqwryrepkdrs