PDB entry 1hus

View 1hus on RCSB PDB site
Description: ribosomal protein s7
Class: ribosomal protein
Keywords: ribosomal protein, RNA-binding protein, decoding center,
Deposited on 1997-08-08, released 1998-01-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein s7
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: S7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22744
      • modified residue (29)
      • modified residue (57)
      • modified residue (68)
      • modified residue (114)
      • modified residue (123)
      • modified residue (142)
    Domains in SCOPe 2.01: d1husa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1husA (A:)
prrgpvakrdvlpdpiynsklvtrlinkimidgkkskaqkilytafdiirertgkdpmev
feqalknvmpvlevrarrvgganyqvpvevrpdrrvslglrwlvqyarlrnektmeerla
neimdaanntgaavkkredthkmaeankafahyrw

    Sequence, based on observed residues (ATOM records): (download) 
    >1husA (A:)
rdvlpdpiynsklvtrlinkimidgkkskaqkilytafdiirertgkdpmevfeqalknv
mpvlevrarrvgganyqvpvevrpdrrvslglrwlvqyarlrnektmeerlaneimdaan
ntgaavkkredthkmaean