PDB entry 1huq

View 1huq on RCSB PDB site
Description: 1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Deposited on 2001-01-04, released 2001-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1huqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1huqA (A:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqtvclddttvkfeiwdta
    gqeryhslapmyyrgaqaaivvyditntdtfaraknwvkelqrqaspnivialagnkadl
    askravefqeaqayaddnsllfmetsaktamnvneifmaiakkl