PDB entry 1hul

View 1hul on RCSB PDB site
Description: a novel dimer configuration revealed by the crystal structure at 2.4 angstroms resolution of human interleukin-5
Deposited on 1995-03-17, released 1995-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-12-07, with a file datestamp of 1995-12-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hula_
  • Chain 'B':
    Domains in SCOP 1.55: d1hulb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hulA (A:)
    iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
    verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hulB (B:)
    iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
    verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi