PDB entry 1hsq

View 1hsq on RCSB PDB site
Description: solution structure of the sh3 domain of phospholipase cgamma
Class: phosphoric diester hydrolase
Keywords: phosphoric diester hydrolase
Deposited on 1994-06-13, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase c-gamma (sh3 domain)
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hsqa1, d1hsqa2, d1hsqa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hsqA (A:)
gsptfkcavkalfdykaqredeltfiksaiiqnvekqeggwwrgdyggkkqlwfpsnyve
emvnpegihrd