PDB entry 1hsk

View 1hsk on RCSB PDB site
Description: crystal structure of s. aureus murb
Class: oxidoreductase
Keywords: peptidoglycan synthesis, cell wall, cell division, oxidoreductase, nadp, flavoprotein, fad
Deposited on 2000-12-27, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylenolpyruvoylglucosamine reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hska1, d1hska2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hskA (A:)
    mrgshhhhhhtdpinkdiyqalqqlipnekikvdeplkrytytktggnadfyitptknee
    vqavvkyayqneipvtylgngsniiireggirgivisllsldhievsddaiiagsgaaii
    dvsrvardyaltglefacgipgsiggavymnagayggevkdcidyalcvneqgslikltt
    keleldyrnsiiqkehlvvleaaftlapgkmteiqakmddlterreskqpleypscgsvf
    qrppghfagkliqdsnlqghriggvevstkhagfmvnvdngtatdyenlihyvqktvkek
    fgielnrevriigehpkeslqpslis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hskA (A:)
    nkdiyqalqqlipnekikvdeplkrytytktggnadfyitptkneevqavvkyayqneip
    vtylgngsniiireggirgivisllsldhievsddaiiagsgaaiidvsrvardyaltgl
    efacgipgsiggavymnagayggevkdcidyalcvneqgsliklttkeleldyrnsiiqk
    ehlvvleaaftlapgkmteiqakmddlterreskqpleypscgsvfqrppghfagkliqd
    snlqghriggvevstkhagfmvnvdngtatdyenlihyvqktvkekfgielnrevriige
    hpk