PDB entry 1hsh

View 1hsh on RCSB PDB site
Description: crystal structure at 1.9 angstroms resolution of human immunodeficiency virus (hiv) ii protease complexed with l-735,524, an orally bioavailable inhibitor of the hiv proteases
Deposited on 1995-03-31, released 1996-04-03
The last revision prior to the SCOP 1.55 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1hsha_
  • Chain 'B':
    Domains in SCOP 1.55: d1hshb_
  • Chain 'C':
    Domains in SCOP 1.55: d1hshc_
  • Chain 'D':
    Domains in SCOP 1.55: d1hshd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hshA (A:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hshB (B:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hshC (C:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hshD (D:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintkeyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl