PDB entry 1hrm

View 1hrm on RCSB PDB site
Description: the proximal ligand variant his93tyr of horse heart myoglobin
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1994-09-21, released 1995-01-26
The last revision prior to the SCOP 1.75 freeze date was dated 1995-01-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.151
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68082 (0-152)
      • conflict (92)
    Domains in SCOP 1.75: d1hrma_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrmA (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqsyatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfqg