PDB entry 1hrf

View 1hrf on RCSB PDB site
Description: solution structure of the epidermal growth factor-like domain of heregulin-alpha, a ligand for p180erb4
Class: growth factor
Keywords: growth factor
Deposited on 1994-07-21, released 1994-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 1994-10-15, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heregulin alpha
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hrfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hrfA (A:)
gtshlvkcaekektfcvnggecfmvkdlsnpsrylckcqpgftgarctenvpmkvqnqek
aeelyqk