PDB entry 1hrd

View 1hrd on RCSB PDB site
Description:
Deposited on 1996-04-03, released 1997-03-12
The last revision prior to the SCOP 1.67 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.172
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1hrda1, d1hrda2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1hrdb1, d1hrdb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1hrdc1, d1hrdc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrdA (A:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgn
    vawgaakklaelgakavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfg
    vqffpgekpwgqkvdiimpcatqndvdleqakkivannvkyyievanmpttnealrflmq
    qpnmvvapskavnaggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaery
    glgynlvaganivgfqkiadammaqgiaw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrdB (B:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgn
    vawgaakklaelgakavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfg
    vqffpgekpwgqkvdiimpcatqndvdleqakkivannvkyyievanmpttnealrflmq
    qpnmvvapskavnaggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaery
    glgynlvaganivgfqkiadammaqgiaw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hrdC (C:)
    skyvdrviaevekkyadepefvqtveevlsslgpvvdahpeyeevallermvipervief
    rvpweddngkvhvntgyrvqfngaigpykgglrfapsvnlsimkflgfeqafkdslttlp
    mggakggsdfdpngksdrevmrfcqafmtelyrhigpdidvpagdlgvgareigymygqy
    rkivggfyngvltgkarsfggslvrpeatgygsvyyveavmkhendtlvgktvalagfgn
    vawgaakklaelgakavtlsgpdgyiydpegitteekinymlemrasgrnkvqdyadkfg
    vqffpgekpwgqkvdiimpcatqndvdleqakkivannvkyyievanmpttnealrflmq
    qpnmvvapskavnaggvlvsgfemsqnserlswtaeevdsklhqvmtdihdgsaaaaery
    glgynlvaganivgfqkiadammaqgiaw