PDB entry 1hq8

View 1hq8 on RCSB PDB site
Description: crystal structure of the murine nk cell-activating receptor nkg2d at 1.95 a
Deposited on 2000-12-14, released 2001-03-07
The last revision prior to the SCOP 1.59 freeze date was dated 2001-03-07, with a file datestamp of 2001-03-07.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.215
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hq8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq8A (A:)
    gycgpcpnnwichrnncyqffneektwnqsqasclsqnssllkiyskeeqdflklvksyh
    wmglvqipangswqwedgsslsynqltlveipkgscavygssfkaytedcanlntyicmk
    rav