PDB entry 1hq4

View 1hq4 on RCSB PDB site
Description: structure of native catalytic antibody ha5-19a4
Class: immune system
Keywords: CATALYTIC ANTIBODY, TERPENOID SYNTHASE, CARBOCATION, CYCLIZATION CASCADE, IMMUNOGLOBULIN, immune system
Deposited on 2000-12-14, released 2003-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antibody ha5-19a4 fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hq4a1, d1hq4a2
  • Chain 'B':
    Compound: antibody ha5-19a4 fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hq4b1, d1hq4b2
  • Chain 'C':
    Compound: antibody ha5-19a4 fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hq4c1, d1hq4c2
  • Chain 'D':
    Compound: antibody ha5-19a4 fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hq4d1, d1hq4d2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq4A (A:)
    divltqsptimsvspgekvtltcsasssvssnyvywyqqkpgsspkvwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaasyfclqwssfpytfgggtklelkradvaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hq4B (B:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepkdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hq4B (B:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hq4C (C:)
    divltqsptimsvspgekvtltcsasssvssnyvywyqqkpgsspkvwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaasyfclqwssfpytfgggtklelkradvaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hq4D (D:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepkdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hq4D (D:)
    dvqlqesgpglvkpsqslsltctvtgysitsgyawnwirqfpgnklewmgyirysgdtry
    npslksrisitrdtsknqfflqlnsvttedtatyycaigygnsdywgqgtlvtvsaaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhafpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklepk