PDB entry 1hpt

View 1hpt on RCSB PDB site
Description: three-dimensional structure of a recombinant variant of human pancreatic secretory trypsin inhibitor (kazal type)
Deposited on 1992-03-27, released 1993-10-31
The last revision prior to the SCOP 1.67 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1hpt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hpt_ (-)
    dslgreakcynelngctyeyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc