PDB entry 1hp6

View 1hp6 on RCSB PDB site
Description: crystal structure of a hairpin ribozyme in the catalytically-active conformation
Deposited on 2000-12-12, released 2001-04-12
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.251
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.57: d1hp6c_
  • Chain 'F':
    Domains in SCOP 1.57: d1hp6f_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hp6C (C:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hp6F (F:)
    trpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssa
    tnalrsmqgfpfydkpmriqyaktdsdiiakm