PDB entry 1hov

View 1hov on RCSB PDB site
Description: solution structure of a catalytic domain of mmp-2 complexed with sc-74020
Class: hydrolase/hydrolase inhibitor
Keywords: enzyme-inhibitor complex, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-12-11, released 2001-12-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix metalloproteinase-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hova_
  • Heterogens: ZN, CA, I52

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hovA (A:)
    mynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgead
    iminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtntsanyslflvaah
    efghamglehsqdpgalmapiytytknfrlsqddikgiqelyg