PDB entry 1hot

View 1hot on RCSB PDB site
Description: glucosamine 6-phosphate deaminase complexed with the allosteric activator n-acetyl-glucosamine-6-phosphate
Deposited on 1995-11-17, released 1996-04-03
The last revision prior to the SCOP 1.59 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.165
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hota_
  • Chain 'B':
    Domains in SCOP 1.59: d1hotb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hotA (A:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
    vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
    epstmelkvktlryfneleaenikgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hotB (B:)
    mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
    vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
    yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
    vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
    epstmelkvktlryfneleaenikgl