PDB entry 1hoc

View 1hoc on RCSB PDB site
Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection
Class: histocompatibility antigen
Keywords: histocompatibility antigen
Deposited on 1994-01-02, released 1994-04-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class I histocompatibility antigen (h2-db) (alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hoca1, d1hoca2
  • Chain 'B':
    Compound: beta 2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hocb_
  • Chain 'C':
    Compound: 9-residue peptide
    Species: Influenza A virus (A/swine/Hong Kong/126/82(H3N2)) [TaxId:11498]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hocA (A:)
    gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
    eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
    rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
    rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
    fqkwasvvvplgkeqnytcrvyheglpepltl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hocB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.