SCOPe 2.05: Structural Classification of Proteins

PDB entry 1hnz

View 1hnz on RCSB PDB site
Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Class: ribosome
Keywords: 30s ribosomal subunit, ribosome, antibiotic, hygromycin b
Deposited on 2000-12-08, released 2001-02-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.218
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 16S ribosomal RNA
Species: Thermus thermophilus [TaxId:274]
Chain 'B':
Compound: 30S ribosomal protein S2
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- PDB 1HNZ
Domains in SCOPe 2.05: d1hnzb_
Chain 'C':
Compound: 30S ribosomal protein S3
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- PDB 1HNZ
Domains in SCOPe 2.05: d1hnzc1, d1hnzc2
Chain 'D':
Compound: 30S ribosomal protein S4
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80373 (Start-208)
Domains in SCOPe 2.05: d1hnzd_
Chain 'E':
Compound: 30S ribosomal protein S5
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P27152
Domains in SCOPe 2.05: d1hnze1, d1hnze2
Chain 'F':
Compound: 30S ribosomal protein S6
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P23370 (0-100)
Domains in SCOPe 2.05: d1hnzf_
Chain 'G':
Compound: 30S ribosomal protein S7
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P17291 (Start-155)
Domains in SCOPe 2.05: d1hnzg_
Chain 'H':
Compound: 30S ribosomal protein S8
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P24319 (0-137)
Domains in SCOPe 2.05: d1hnzh_
Chain 'I':
Compound: 30S ribosomal protein S9
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- PDB 1HNZ (Start-127)
Domains in SCOPe 2.05: d1hnzi_
Chain 'J':
Compound: 30S ribosomal protein S10
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80375
Domains in SCOPe 2.05: d1hnzj_
Chain 'K':
Compound: 30S ribosomal protein S11
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- GB BAA75547 (Start-128)
Domains in SCOPe 2.05: d1hnzk_
Chain 'L':
Compound: 30S ribosomal protein S12
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P17293
Domains in SCOPe 2.05: d1hnzl_
Chain 'M':
Compound: 30S ribosomal protein S13
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- GB BAA75546 (Start-125)
Domains in SCOPe 2.05: d1hnzm_
Chain 'N':
Compound: 30S ribosomal protein S14
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P24320 (Start-60)
Domains in SCOPe 2.05: d1hnzn_
Chain 'O':
Compound: 30S ribosomal protein S15
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80378 (Start-88)
Domains in SCOPe 2.05: d1hnzo_
Chain 'P':
Compound: 30S ribosomal protein S16
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- PDB 1HNZ (0-87)
Domains in SCOPe 2.05: d1hnzp_
Chain 'Q':
Compound: 30S ribosomal protein S17
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- EMBL CAA85419 (Start-104)
Domains in SCOPe 2.05: d1hnzq_
Chain 'R':
Compound: 30S ribosomal protein S18
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- GB AAF27297 (Start-87)
Domains in SCOPe 2.05: d1hnzr_
Chain 'S':
Compound: 30S ribosomal protein S19
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P80381
Domains in SCOPe 2.05: d1hnzs_
Chain 'T':
Compound: 30S ribosomal protein S20
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- PDB 1HNZ (Start-105)
Domains in SCOPe 2.05: d1hnzt_
Chain 'V':
Compound: 30S ribosomal protein Thx
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Uniprot P32193 (0-End)
Domains in SCOPe 2.05: d1hnzv_
Chain 'X':
Compound: fragment of messenger RNA
Species: Thermus thermophilus [TaxId:274]
Heterogens: MG, ZN, HYG

PDB Chain Sequences:

Chain 'A':
No sequence available.

Chain 'B':
Sequence, based on SEQRES records: (download)

>1hnzB (B:)
mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
eaeatetpegesevea