PDB entry 1hnl

View 1hnl on RCSB PDB site
Description: crystal structure of a glutathionylated human lysozyme: a folding intermediate mimic in the formation of a disulfide bond
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1994-12-22, released 1995-02-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.125
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human lysozyme
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
    • conflict (76)
  Domains in SCOPe 2.04: d1hnla_
• Heterogens: GSH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hnlA (A:)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnaahlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv