PDB entry 1hnl

View 1hnl on RCSB PDB site
Description:
Deposited on 1994-12-22, released 1995-02-14
The last revision prior to the SCOP 1.71 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.125
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1hnl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hnl_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnaahlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv