PDB entry 1hnl

View 1hnl on RCSB PDB site
Description: crystal structure of a glutathionylated human lysozyme: a folding intermediate mimic in the formation of a disulfide bond
Deposited on 1994-12-22, released 1995-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.125
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1hnl__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hnl_ (-)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnaahlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv