PDB entry 1hng

View 1hng on RCSB PDB site
Description: crystal structure at 2.8 angstroms resolution of a soluble form of the cell adhesion molecule cd2
Deposited on 1994-08-10, released 1995-02-07
The last revision prior to the SCOP 1.67 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hngA (A:)
    rdsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilan
    gdlkiknltrddsgtynvtvystngtrilnkaldlrilemvskpmiywecsnatltcevl
    egtdvelklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hngA (A:)
    dsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilang
    dlkiknltrddsgtynvtvystngtrilnkaldlrilemvskpmiywecsnatltcevle
    gtdvelklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hngB (B:)
    rdsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilan
    gdlkiknltrddsgtynvtvystngtrilnkaldlrilemvskpmiywecsnatltcevl
    egtdvelklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hngB (B:)
    dsgtvwgalghginlnipnfqmtddidevrwergstlvaefkrkmkpflksgafeilang
    dlkiknltrddsgtynvtvystngtrilnkaldlrilemvskpmiywecsnatltcevle
    gtdvelklyqgkehlrslrqktmsyqwtnlrapfkckavnrvsqesemevvncpe