PDB entry 1hn0

View 1hn0 on RCSB PDB site
Description: crystal structure of chondroitin abc lyase I from proteus vulgaris at 1.9 angstroms resolution
Class: lyase
Keywords: chondroitinase ABC I, chonroitin digestion, mechanism, LYASE
Deposited on 2000-12-05, released 2003-04-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.158
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chondroitin abc lyase I
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1hn0a1, d1hn0a2, d1hn0a3, d1hn0a4
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hn0A (A:)
    mpifrftalamtlgllsapynamaatsnpafdpknlmqseiyhfaqnnpladfssdknsi
    ltlsdkrsimgnqsllwkwkggssftlhkklivptdkeaskawgrsstpvfsfwlynekp
    idgyltidfgeklistseaqagfkvkldftgwravgvslnndlenremtlnatntssdgt
    qdsigrslgakvdsirfkapsnvsqgeiyidrimfsvddaryqwsdyqvktrlsepeiqf
    hnvkpqlpvtpenlaaidlirqrlinefvggeketnlaleenisklksdfdalnihtlan
    ggtqgrhlitdkqiiiyqpenlnsqdkqlfdnyvilgnyttlmfnisrayvlekdptqka
    qlkqmyllmtkhlldqgfvkgsalvtthhwgyssrwwyistllmsdalkeanlqtqvyds
    llwysrefkssfdmkvsadssdldyfntlsrqhlallllepddqkrinlvntfshyitga
    ltqvppggkdglrpdgtawrhegnypgysfpafknasqliyllrdtpfsvgesgwnnlkk
    amvsawiysnpevglplagrhpfnspslksvaqgyywlamsaksspdktlasiylaisdk
    tqnestaifgetitpaslpqgfyafnggafgihrwqdkmvtlkayntnvwsseiynkdnr
    ygryqshgvaqivsngsqlsqgyqqegwdwnrmegattihlplkdldspkphtlmqrger
    gfsgtsslegqygmmafnliypanlerfdpnftakksvlaadnhlifigsninssdknkn
    vettlfqhaitptlntlwingqkienmpyqttlqqgdwlidsngngylitqaekvnvsrq
    hqvsaenknrqptegnfssawidhstrpkdasyeymvfldatpekmgemaqkfrenngly
    qvlrkdkdvhiildklsnvtgyafyqpasiedkwikkvnkpaivmthrqkdtlivsavtp
    dlnmtrqkaatpvtinvtingkwqsadknsevkyqvsgdnteltftsyfgipqeiklspl
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hn0A (A:)
    atsnpafdpknlmqseiyhfaqnnpladfssdknsiltlsdkrsimgnqsllwkwkggss
    ftlhkklivptdkeaskawgrsstpvfsfwlynekpidgyltidfgeklistseaqagfk
    vkldftgwravgvslnndlenvdsirfkapsnvsqgeiyidrimfsvddaryqwsdyqvk
    trlsepeiqfhnvkpqlpvtpenlaaidlirqrlinefvggeketnlaleenisklksdf
    dalnihtlanggtqgrhlitdkqiiiyqpenlnsqdkqlfdnyvilgnyttlmfnisray
    vlekdptqkaqlkqmyllmtkhlldqgfvkgsalvtthhwgyssrwwyistllmsdalke
    anlqtqvydsllwysrefkssfdmkvsadssdldyfntlsrqhlallllepddqkrinlv
    ntfshyitgaltqvppggkdglrpdgtawrhegnypgysfpafknasqliyllrdtpfsv
    gesgwnnlkkamvsawiysnpevglplagrhpfnspslksvaqgyywlamsaksspdktl
    asiylaisdktqnestaifgetitpaslpqgfyafnggafgihrwqdkmvtlkayntnvw
    sseiynkdnrygryqshgvaqivsngsqlsqgyqqegwdwnrmegattihlplkdldspk
    phtlmqrgergfsgtsslegqygmmafnliypanlerfdpnftakksvlaadnhlifigs
    ninssdknknvettlfqhaitptlntlwingqkienmpyqttlqqgdwlidsngngylit
    qaekvnvsrqhqvsaenknrqptegnfssawidhstrpkdasyeymvfldatpekmgema
    qkfrennglyqvlrkdkdvhiildklsnvtgyafyqpasiedkwikkvnkpaivmthrqk
    dtlivsavtpdlnmtrqkaatpvtinvtingkwqsadknsevkyqvsgdnteltftsyfg
    ipqeiklsplp