PDB entry 1hmt

View 1hmt on RCSB PDB site
Description: 1.4 angstroms structural studies on human muscle fatty acid binding protein: binding interactions with three saturated and unsaturated c18 fatty acids
Class: lipid binding protein
Keywords: lipid-binding protein, lipid binding protein
Deposited on 1994-01-02, released 1995-05-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muscle fatty acid binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hmta_
  • Heterogens: STE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1hmtA (A:)
vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyekea

    Sequence, based on observed residues (ATOM records): (download) 
    >1hmtA (A:)
vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyeke