SCOPe 2.05: Structural Classification of Proteins

PDB entry 1hms

View 1hms on RCSB PDB site
Description: 1.4 angstroms structural studies on human muscle fatty acid binding protein: binding interactions with three saturated and unsaturated c18 fatty acids
Class: lipid-binding protein
Keywords: lipid-binding protein
Deposited on 1994-01-02, released 1995-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.121
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: muscle fatty acid binding protein
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P05413 (0-End)
Domains in SCOPe 2.05: d1hmsa_
Heterogens: OLA, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1hmsA (A:)
vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyekea

Sequence, based on observed residues (ATOM records): (download)

>1hmsA (A:)
vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
tavctrtyeke