PDB entry 1hlv

View 1hlv on RCSB PDB site
Description: crystal structure of cenp-b(1-129) complexed with the cenp-b box DNA
Class: DNA binding protein/DNA
Keywords: HELIX-TURN-HELIX, PROTEIN-DNA COMPLEX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2000-12-04, released 2002-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.222
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: major centromere autoantigen b
  Species: Homo sapiens [TaxId:9606]
  Gene: CENP-B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07199 (0-128)
    • cloning artifact (129-130)
  Domains in SCOPe 2.07: d1hlva1, d1hlva2, d1hlva3
• Chain 'B':
  Compound: cenp-b box DNA
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: cenp-b box DNA
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hlvA (A:)
  mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailaserkyg
  vastcrktnklspydkleglliawfqqiraaglpvkgiilkekalriaeelgmddftasn
  gwldrfrrrrs
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.