PDB entry 1hlm

View 1hlm on RCSB PDB site
Description: amino acid sequence of a globin from the sea cucumber caudina (molpadia) arenicola
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1994-08-26, released 1995-02-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.19
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (cyano met)
    Species: Caudina arenicola [TaxId:7698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hlma_
  • Heterogens: CYN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlmA (A:)
    gatqsfqsvgdltpaekdlirstwdqlmthrtgfvadvfirifhndptaqrkfpqmagls
    paelrtsrqmhahairvsalmttyidemdtevlpellatltrthdknhvgkknydlfgkv
    lmeaikaelgvgftkqvhdawaktfaivqgvlitkhas