PDB entry 1hlb

View 1hlb on RCSB PDB site
Description: Structural analysis of monomeric hemichrome and dimeric cyanomet hemoglobins from Caudina arenicola
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1994-03-22, released 1994-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-07-07, with a file datestamp of 2010-07-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.15
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (deoxy)
    Species: Caudina arenicola [TaxId:7698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hlba_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hlbA (A:)
    ggtlaiqaqgdltlaqkkivrktwhqlmrnktsfvtdvfirifaydpsaqnkfpqmagms
    asqlrssrqmqahairvssimseyveeldsdilpellatlarthdlnkvgadhynlfakv
    lmealqaelgsdfnektrdawakafsvvqavllvkhg