PDB entry 1hl6

View 1hl6 on RCSB PDB site
Description: a novel mode of rbd-protein recognition in the y14-mago complex
Class: signal protein
Keywords: signal protein, rdb, exon-exon junction, oskar, rnp, nmd
Deposited on 2003-03-13, released 2003-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg8781 protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hl6a_
  • Chain 'B':
    Compound: mago nashi protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hl6b_
  • Chain 'C':
    Compound: cg8781 protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1hl6c_
  • Chain 'D':
    Compound: mago nashi protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49028 (Start-146)
    • PDB 1HL6 (147-148)
    Domains in SCOPe 2.07: d1hl6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hl6A (A:)
    madvldidnaeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrneddd
    elepgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalve
    yethkqalaakealngaeimgqtiqvdwcfvkgpkrvkksekrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl6A (A:)
    aeefevdedgdqgivrlkekakhrkgrgfgpgpqrsvegwilfvtsiheeaqedeiqekf
    cdygeiknihlnldrrtgfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hl6B (B:)
    mstedfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmee
    lkriiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpegl
    rcfyylvqdlkclvfsliglhfkikpipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl6B (B:)
    edfylryyvghkgkfgheflefefrpdgklryannsntmirkeafvhqsvmeelkriiid
    seimqeddlpwpppdrvgrqeleivigdehisfttsktlvdvnrskdpeglrcfyylvqd
    lkclvfsliglhfkikp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1hl6C (C:)
    madvldidnaeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrneddd
    elepgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalve
    yethkqalaakealngaeimgqtiqvdwcfvkgpkrvkksekrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl6C (C:)
    efevdedgdqgivrlkekakhrkgrgfpgpqrsvegwilfvtsiheeaqedeiqekfcdy
    geiknihlnlfskgyalveyethkqalaakealngaeimgqtiqvdwcfvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1hl6D (D:)
    mstedfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmee
    lkriiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpegl
    rcfyylvqdlkclvfsliglhfkikpipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hl6D (D:)
    dfylryyvghkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmeelkriii
    dseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcfyyl
    vqdlkclvfsliglhfkikpipr