PDB entry 1hkw

View 1hkw on RCSB PDB site
Description: mycobacterium diaminopimelate dicarboxylase (lysa)
Deposited on 2003-03-11, released 2003-03-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-16, with a file datestamp of 2003-05-16.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.19526
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hkwA (A:)
    mnellhlapnvwprnttrdevgvvciagipltqlaqeygtplfvideddfrsrcretaaa
    fgsganvhyaakaflcsevarwiseeglcldvctggelavalhasfpperitlhgnnksv
    seltaavkagvghivvdsmteierldaiageagivqdvlvrltvgveahthefistahed
    qkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfelaahrvigllrdvvg
    efgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsdestavglptpklvve
    pgraiagpgtitlyevgtvkdvdvsatahrryvsvdggmsdnirtalygaqydvrlvsrv
    sdappvparlvgkhcesgdiivrdtwvpddirpgdlvavaatgaycyslssrynmvgrpa
    vvavhagnarlvlrretvddllslevrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkwA (A:)
    nellhlapnvwprnttrdevgvvciagipltqlaqeygtplfvideddfrsrcretaaaf
    gsganvhyaakaflcsevarwiseeglcldvctggelavalhasfpperitlhgnnksvs
    eltaavkagvghivvdsmteierldaiageagivqdvlvrltvgveahthefistahedq
    kfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfelaahrvigllrdvvge
    fgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsdestavglptpklvvep
    graiagpgtitlyevgtvkdvdvsatahrryvsvdggmsdnirtalygaqydvrlvsrvs
    dappvparlvgkhcesgdiivrdtwvpddirpgdlvavaatgaycyslssrynmvgrpav
    vavhagnarlvlrretvddllslevr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hkwB (B:)
    mnellhlapnvwprnttrdevgvvciagipltqlaqeygtplfvideddfrsrcretaaa
    fgsganvhyaakaflcsevarwiseeglcldvctggelavalhasfpperitlhgnnksv
    seltaavkagvghivvdsmteierldaiageagivqdvlvrltvgveahthefistahed
    qkfglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfelaahrvigllrdvvg
    efgpektaqiatvdlggglgisylpsddpppiaelaaklgtivsdestavglptpklvve
    pgraiagpgtitlyevgtvkdvdvsatahrryvsvdggmsdnirtalygaqydvrlvsrv
    sdappvparlvgkhcesgdiivrdtwvpddirpgdlvavaatgaycyslssrynmvgrpa
    vvavhagnarlvlrretvddllslevrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hkwB (B:)
    ellhlapnvwprnttrdevgvvciagipltqlaqeygtplfvideddfrsrcretaaafg
    sganvhyaakaflcsevarwiseeglcldvctggelavalhasfpperitlhgnnksvse
    ltaavkagvghivvdsmteierldaiageagivqdvlvrltvgveahthefistahedqk
    fglsvasgaamaavrrvfatdhlrlvglhshigsqifdvdgfelaahrvigllrdvvgef
    gpektaqiatvdlggglgisylpsddpppiaelaaklgtivsdestavglptpklvvepg
    raiagpgtitlyevgtvkdvdvsatahrryvsvdggmsdnirtalygaqydvrlvsrvsd
    appvparlvgkhcesgdiivrdtwvpddirpgdlvavaatgaycyslssrynmvgrpavv
    avhagnarlvlrretvddllslev