PDB entry 1hkm

View 1hkm on RCSB PDB site
Description: high resolution crystal structure of human chitinase in complex with demethylallosamidin
Class: hydrolase
Keywords: human chitinase, hydrolase, chitin degradation, crystal structure, demethylallosamidin
Deposited on 2003-03-10, released 2004-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitotriosidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13231 (0-364)
      • conflict (212)
    Domains in SCOPe 2.06: d1hkma1, d1hkma2
  • Heterogens: ALI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hkmA (A:)
    aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
    glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
    pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
    qnldfvnlmaydfhgswekvtghnsplykrqeqsgaaaslnvdaavqqwlqkgtpaskli
    lgmptygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqk
    vpyifrdnqwvgfddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtl
    rqels