PDB entry 1hkl

View 1hkl on RCSB PDB site
Description: free and liganded form of an esterolytic catalytic antibody
Deposited on 1996-12-20, released 1997-03-12
The last revision prior to the SCOP 1.63 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hklH (H:)
    qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpkqglewigridpanvdtky
    dpkfqdkatitadtsskttylqlssltsedtavyycasyygiywgqgttltvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hklL (L:)
    diqmtqspsslsaslgervsltcrasqeingylgwlqqkpdgtikrliyaastlhsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec