PDB entry 1hk7

View 1hk7 on RCSB PDB site
Description: middle domain of hsp90
Deposited on 2003-03-06, released 2004-01-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-01-29, with a file datestamp of 2004-01-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1hk7a_
  • Chain 'B':
    Domains in SCOP 1.69: d1hk7b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hk7A (A:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
    eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvi
    rknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvd
    eltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftq
    lkefegktlvditkdfeleetdeekaerekeikeyepltkalkeilgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk7A (A:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
    eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnqnkimkvirknivkk
    lieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltd
    yvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefegk
    tlvditkdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1hk7B (B:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdlf
    eskkkknniklyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvi
    rknivkklieafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvd
    eltsltdyvtrmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftq
    lkefegktlvditkdfeleetdeekaerekeikeyepltkalkeilgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk7B (B:)
    tkplwtrnpsditqeeynafyksisndwedplyvkhfsvegqlefrailfipkrapfdli
    klyvrrvfitdeaedlipewlsfvkgvvdsedlplnlsremlqqnkimkvirknivkkli
    eafneiaedseqfekfysafskniklgvhedtqnraalakllrynstksvdeltsltdyv
    trmpehqkniyyitgeslkavekspfldalkaknfevlfltdpideyaftqlkefegktl
    vditkdf