PDB entry 1hk6

View 1hk6 on RCSB PDB site
Description: ral binding domain from sec5
Deposited on 2003-03-05, released 2003-03-13
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-08, with a file datestamp of 2003-05-08.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1hk6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hk6A (A:)
hmrqpplvtgispnegipwtkvtirgenlgtgptdliglticghnclltaewmsaskivc
rvgqakndkgdiivttksggkgtstvsfkllkpek