PDB entry 1hk5

View 1hk5 on RCSB PDB site
Description: human serum albumin mutant r218h complexed with thyroxine (3,3',5,5'-tetraiodo-l-thyronine) and myristic acid (tetradecanoic acid)
Class: plasma protein
Keywords: plasma protein, hormone-binding, lipid-binding, thyroxine, familial dysalbuminemic hyperthyroxinemia
Deposited on 2003-03-05, released 2003-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.199
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02768
      • engineered mutation (217)
    Domains in SCOPe 2.07: d1hk5a1, d1hk5a2, d1hk5a3
  • Heterogens: MYR, T44, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hk5A (A:)
    dahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesae
    ncdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpev
    dvmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllp
    kldelrdegkassakqrlkcaslqkfgerafkawavahlsqrfpkaefaevsklvtdltk
    vhtecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempa
    dlpslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekc
    caaadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvst
    ptlvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkcctes
    lvnrrpcfsalevdetyvpkefnaetftfhadictlsekerqikkqtalvelvkhkpkat
    keqlkavmddfaafvekcckaddketcfaeegkklvaasqaalgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk5A (A:)
    hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
    dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
    mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
    delrdegkassakqrlkcaslqkfgerafkawavahlsqrfpkaefaevsklvtdltkvh
    tecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempadl
    pslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekcca
    aadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvstpt
    lvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkccteslv
    nrrpcfsalevdetyvpkefnaetftfhadictlsekerqikkqtalvelvkhkpkatke
    qlkavmddfaafvekcckaddketcfaeegkklvaasqaalg