PDB entry 1hk3

View 1hk3 on RCSB PDB site
Description: human serum albumin mutant r218p complexed with thyroxine (3,3',5,5'-tetraiodo-l-thyronine)
Class: plasma protein
Keywords: plasma protein, hormone-binding, lipid-binding, thyroxine, familial dysalbuminemic hyperthyroxinemia
Deposited on 2003-03-05, released 2003-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.203
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serum albumin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02768
      • engineered mutation (217)
    Domains in SCOPe 2.07: d1hk3a1, d1hk3a2, d1hk3a3
  • Heterogens: T44, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1hk3A (A:)
    dahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesae
    ncdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpev
    dvmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllp
    kldelrdegkassakqrlkcaslqkfgerafkawavaplsqrfpkaefaevsklvtdltk
    vhtecchgdllecaddradlakyicenqdsissklkeccekpllekshciaevendempa
    dlpslaadfveskdvcknyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekc
    caaadphecyakvfdefkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvst
    ptlvevsrnlgkvgskcckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkcctes
    lvnrrpcfsalevdetyvpkefnaetftfhadictlsekerqikkqtalvelvkhkpkat
    keqlkavmddfaafvekcckaddketcfaeegkklvaasqaalgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1hk3A (A:)
    sevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencdk
    slhtlfgdklctdccakqepernecflqhkddnpnlprlvrpevdvmctafhdneetflk
    kylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrdegkassakq
    rlkcaslqkfgerafkawavaplsqrfpkaefaevsklvtdltkvhtecchgdllecadd
    radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
    knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
    fkplveepqnlikqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgsk
    cckhpeakrmpcaedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdet
    yvpkefnaetftfhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafve
    kcckaddketcfaeegkkl