PDB entry 1hjt

View 1hjt on RCSB PDB site
Description: sperm whale myoglobin (ferrous, nitric oxide bound)
Class: oxygen transport
Keywords: globin, heme, oxygen storage, nitric oxide, oxygen transport
Deposited on 1997-06-24, released 1997-11-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-152)
  Domains in SCOPe 2.01: d1hjta_
• Heterogens: SO4, HEM, NO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hjtA (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg