PDB entry 1hjs

View 1hjs on RCSB PDB site
Description: structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
Class: hydrolase
Keywords: beta-1, 4-galactanases, family 53 glycoside hydrolase, thermostability, ph optimum, clan gh-a, thermophile, alkalophile, hydrolase
Deposited on 2003-02-27, released 2003-06-02
The last revision prior to the SCOP 1.75 freeze date was dated 2003-06-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.194
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1,4-galactanase
    Species: Thielavia heterothallica
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hjsa_
  • Chain 'B':
    Compound: beta-1,4-galactanase
    Species: Thielavia heterothallica
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hjsb_
  • Chain 'C':
    Compound: beta-1,4-galactanase
    Species: Thielavia heterothallica
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hjsc_
  • Chain 'D':
    Compound: beta-1,4-galactanase
    Species: Thielavia heterothallica
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1hjsd_
  • Heterogens: NAG, SO4, EPE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjsA (A:)
    altyrgvdwssvvveeragvsykntngnaqplenilaangvntvrqrvwvnpadgnynld
    yniaiakrakaaglgvyidfhysdtwadpahqtmpagwpsdidnlswklynytldaankl
    qnagiqptivsigneiragllwptgrtenwaniarllhsaawgikdsslspkpkimihld
    ngwdwgtqnwwytnvlkqgtlelsdfdmmgvsfypfysssatlsalkssldnmaktwnke
    iavvetnwpiscpnprysfpsdvknipfspegqttfitnvanivssvsrgvglfywepaw
    ihnanlgsscadntmfsqsgqalsslsvfqri
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjsB (B:)
    altyrgvdwssvvveeragvsykntngnaqplenilaangvntvrqrvwvnpadgnynld
    yniaiakrakaaglgvyidfhysdtwadpahqtmpagwpsdidnlswklynytldaankl
    qnagiqptivsigneiragllwptgrtenwaniarllhsaawgikdsslspkpkimihld
    ngwdwgtqnwwytnvlkqgtlelsdfdmmgvsfypfysssatlsalkssldnmaktwnke
    iavvetnwpiscpnprysfpsdvknipfspegqttfitnvanivssvsrgvglfywepaw
    ihnanlgsscadntmfsqsgqalsslsvfqri
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjsC (C:)
    altyrgvdwssvvveeragvsykntngnaqplenilaangvntvrqrvwvnpadgnynld
    yniaiakrakaaglgvyidfhysdtwadpahqtmpagwpsdidnlswklynytldaankl
    qnagiqptivsigneiragllwptgrtenwaniarllhsaawgikdsslspkpkimihld
    ngwdwgtqnwwytnvlkqgtlelsdfdmmgvsfypfysssatlsalkssldnmaktwnke
    iavvetnwpiscpnprysfpsdvknipfspegqttfitnvanivssvsrgvglfywepaw
    ihnanlgsscadntmfsqsgqalsslsvfqri
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hjsD (D:)
    altyrgvdwssvvveeragvsykntngnaqplenilaangvntvrqrvwvnpadgnynld
    yniaiakrakaaglgvyidfhysdtwadpahqtmpagwpsdidnlswklynytldaankl
    qnagiqptivsigneiragllwptgrtenwaniarllhsaawgikdsslspkpkimihld
    ngwdwgtqnwwytnvlkqgtlelsdfdmmgvsfypfysssatlsalkssldnmaktwnke
    iavvetnwpiscpnprysfpsdvknipfspegqttfitnvanivssvsrgvglfywepaw
    ihnanlgsscadntmfsqsgqalsslsvfqri